1
0
0
News
文献高级检索结果x-mol.com
newsletter.x-mol.com
Chunlin Yang,Malgorzata Broncel,Caia Dominicus,Emily Sampson,William J. Blakely,Moritz Treeck,Gustavo Arrizabalaga · The propagation of Toxoplasma gondii is ...
Netzwerk-Profile
Twitter Profil: Alex Wai Chan (@alexwaichan) / TwitterTwitter
In collaboration with Malgorzata Broncel. @Moritz_Treeck · @TheCrick. , we also highlight a critical role for myristoylation of CDPK1 in promoting infection ...
Author Moritz Treeck - E-Librarystipram.ac.id
elibrary.stipram.ac.id
by Stephanie D Nofal, Caia Dominicus, Malgorzata Broncel, Nicholas J Katris, Helen R Flynn, Gustavo Arrizabalaga, Cyrille Y Botté, Brandon M Invergo, ...
Interessen
Final Report Summary - CHEMAMP (Chemical AMPylomics ...europa.eu
cordis.europa.eu
In this Marie Curie IEF project “ChemAMP” led by Dr Malgorzata Broncel (fellow) and Prof Edward W. Tate (scientist in charge) novel chemical tools and ...
Management & Beteiligungen
Malgorzata Broncel - MarketVisual Knowledge Map
www.marketvisual.com
Current Affiliations. General Employment. ASSISTANT at Vanderbilt. ASSISTANT at Vanderbilt. ASSISTANT at Vanderbilt. ASSISTANT at Vanderbilt University ...
Ausbildung
Global profiling of co- and post-translationally N-myristoylated ...pure.york.ac.uk › ... › Publications
pure.york.ac.uk
author = "Emmanuelle Thinon and Serwa, {Remigiusz A.} and Malgorzata Broncel and Brannigan, {James A.} and Ute Brassat and Wright, {Megan H.} and Heal, ...
Bücher
Malgorzata Broncel | Francis Crick Institute | 33 PublicationsTypeset.io
typeset.io
Malgorzata Broncel is an academic researcher from Francis Crick Institute. The author has contributed to research in topic(s): Phosphorylation & Kinase.
Search Results for RSC PublishingRoyal Society of Chemistry
pubs.rsc.org
You searched for: Keywords: Author:Malgorzata Broncel. Articles. Sort search results by. Relevance, Latest, Oldest. Search filters.
Malgorzata Broncel | XanEdu Customization Platform
www.academicpub.com
Author: Malgorzata Broncel. Results. Enzymatically triggered amyloid formation: an approach for studying peptide aggregationElectronic supplementary ...
Synthetic Phosphopeptides and Phosphoproteins as Tools for Studying...
books.google.de
Synthetic Phosphopeptides and Phosphoproteins as Tools for Studying Peptide and Protein Self-assembly. Front Cover. Malgorzata Broncel pages.
Dokumente zum Namen
Single-Stranded DNA as a Cleavable Linker for Bioorthogonal ...American Chemical Society
pubs.acs.org
von T Zheng · · Zitiert von: 25 — Nature Protocols 2015, 10 (7) , https://doi.org nprot ; Malgorzata Broncel, Remigiusz A. Serwa, Paulina Ciepla, ...
A European Journal: Vol 18, No 9 - Chemistry EuropeJohn Wiley
chemistry-europe.onlinelibrary.wiley.com
Dr. Malgorzata Broncel, Dr. Eberhard Krause, Prof. Dr. Dirk Schwarzer, Prof. Dr. Christian P. R. Hackenberger, ... The first semisynthesis of the tau protein is ...
and post-translationally N-myristoylated proteomes in ...ReadCube Papers
www.readcube.com
Emmanuelle Thinon 1,2,* ,w, Remigiusz A. Serwa1, *, Malgorzata Broncel 1 , James A. Brannigan3 , Ute Brassat1,2,w, Megan H. Wright 1,4,w, William P. Heal1,w ...
DIA PublicationsThermo Fisher Scientific
assets.thermofisher.com
Maria Giorgalli, Deirdre A. Cunningham, Malgorzata Broncel,. Aaron Sait, Thomas E. Harrison, Caroline Hosking, Audrey. Vandomme, Sarah I. Amis, ...
Wissenschaftliche Veröffentlichungen
An exported kinase family mediates species-specific ...Archive ouverte HAL
hal.science
von H Davies · · Zitiert von: 33 — An exported kinase family mediates species-specific erythrocyte remodelling and virulence in human malaria. Heledd Davies , Hugo Belda , Malgorzata Broncel , ...
Protein 'map' could lead to potent new cancer drugsScience Daily
www.sciencedaily.com
— Serwa, Malgorzata Broncel, James A. Brannigan, Ute Brassat, Megan H. Wright, William P. Heal, Anthony J. Wilkinson, David J. Mann, Edward W.
DFG GEPRIS - Dr. Malgorzata Broncel
gepris.dfg.de
Dr. Malgorzata Broncel, Department of Chemistry, South Kensington Campus, London SW7 2AZ, Großbritannien
Group Members • Koksch Group • Department of Biology, Chemistry,...
www.bcp.fu-berlin.de
Former AG Koksch Members ... Dr. Malgorzata Broncel: How posttranslational modifications influence amyloid formation: Postdoc, Imperial College of London, UK. Dr. Jessica Falenski: O-glycosylation and depsipeptide bonds - folding aspects of α-helical coiled coils:
Veröffentlichungen allgemein
A new chemical handle for protein AMPylation at the host- ...CORE
core.ac.uk
von M Broncel · Zitiert von: 15 — Malgorzata Broncel, Remigiusz A. Serwa, and Edward W. Tate*. [a]. Post-translational modification (PTM) of proteins plays a role in.
The Rab-binding Profiles of Bacterial Virulence Factors during...
core.ac.uk
By Ernest C. So, Gunnar N. Schroeder, Danielle Carson, Corinna Mattheis, Aurélie Mousnier, Malgorzata Broncel, Edward W. Tate and Gad Frankel.
Chapter 16link.springer.com › content › pdf
link.springer.com
Malgorzata Broncel and Paul H. Huang. Abstract. Robust isolation and identification of peptides phosphorylated at their tyrosine residues are key steps in.
Malgorzata Broncel - Wikidatawww.wikidata.org › wiki
www.wikidata.org
In more languages. Configure. Language, Label, Description, Also known as. English. Malgorzata Broncel. researcher. Spanish. No label defined. investigador.
Artikel & Meinungen
Global profiling of co- and post-translationally N- ...Nature Journal
www.nature.com
von E Thinon · · Zitiert von: 227 — Emmanuelle Thinon, Remigiusz A. Serwa, Malgorzata Broncel, Ute Brassat, Megan H. Wright, William P. Heal & Edward W. Tate.
Predicting Proteome-Early Drug Induced Cardiac Toxicity ...sciforum
sciforum.net
von H González-Díaz · — Malgorzata Broncel et al., Molecular & Cellular Proteomics, Sets2Networks: network inference from repeated observations of sets.
Global profiling of co- and post-translationally N-myristoylated...
www.nature.com
Protein N-myristoylation is a ubiquitous modification implicated in the regulation of multiple cellular processes. Here, Thinon et al. report the development...
Sonstiges
7 Article(s)Frontiers
www.frontiersin.org
Maria Giorgalli · Deirdre A. Cunningham · Malgorzata Broncel · Aaron Sait · Thomas E. Harrison · Caroline Hosking · Audrey Vandomme · Sarah I. Amis ...
An exported kinase family mediates species-specific ...Europe PMC
europepmc.org
von H Davies · · Zitiert von: 33 — An Exported Kinase Family Mediates Species-Specific Erythrocyte Remodelling and Virulence in Human Malaria. Heledd Davies,#1 Hugo Belda,#1Malgorzata Broncel,1 ...
Broncel Namensbedeutung und -herkunftNames Encyclopedia
de.namespedia.com
Nachname Broncel wird mindestens 154-mal in mindestens 3 Ländern benutzt. Familiennamen Broncel. Vornamen Jozef Broncel (6) Jan Broncel (5) Malgorzata Broncel ( ...
Analysis of Phosphotyrosine Signaling Networks in Lung ...Springer Nature
experiments.springernature.com
Analysis of Phosphotyrosine Signaling Networks in Lung Cancer Cell Lines. Authors: Malgorzata Broncel Author Email 2 ,. Paul H. Huang 1.
Cytoplasmic dynein-1 cargo diversity is mediated by the ...Researcher App
www.researcher-app.com
Alex W Chan, Malgorzata Broncel, Nicole R Haseley, Sundeep Chakladar, Elena Andree, Alice L Herneisen, Emily Shortt, Moritz Treeck, Sebastian Lourido.
Differential protein phosphorylation during stage ...OmicsDI
www.omicsdi.org
SUBMITTER: Malgorzata Broncel. LAB HEAD: Moritz Treeck. PROVIDER: PXD | Pride | REPOSITORIES: Pride.
Divergent kinase regulates membrane ultrastructure of the ...elsevierpure.com
utsouthwestern.elsevierpure.com
Tsebaot Beraki, Xiaoyu Hu, Malgorzata Broncel, Joanna C. Young, William J. O'Shaughnessy, Dominika Borek, Moritz Treeck, Michael L. Reese.
Fig Public Library of Science - FigshareFigshare
plos.figshare.com
— Stephanie D. Nofal · Caia Dominicus · Malgorzata Broncel · Nicholas J. Katris · Helen R. Flynn · Gustavo Arrizabalaga · Cyrille Y. Botté · Brandon M.
Global Profiling of Huntingtin-associated protein E (HYPE)Sigma-Aldrich
www.sigmaaldrich.com
Malgorzata Broncel, Remigiusz A Serwa, Tom D Bunney, Matilda Katan, Edward W Tate. PMID ABSTRACT. AMPylation of mammalian small GTPases by ...
Identification of O-GlcNAc sites within peptides of the Tau protein ...Academia.edu
www.academia.edu
Caroline Smet-Nocca,*a Malgorzata Broncel,b Jean-Michel Wieruszeski,a Caroline Tokarski,c Xavier Hanoulle,a Arnaud Leroy,a Isabelle Landrieu,a Christian ...
Inhibition of peptide aggregation by means of enzymatic ...Beilstein Journals
www.beilstein-journals.org
Kristin Folmert, Malgorzata Broncel, Hans v. Berlepsch, Christopher H. Ullrich, Mary-Ann Siegert and Beate Koksch. Beilstein J. Org. Chem.
Myristoylation profiling in human cells and zebrafishCyberLeninka Open Science Hub
cyberleninka.org
Abstract of research paper on Chemical sciences, author of scientific article — Malgorzata Broncel, Remigiusz A Serwa, Paulina Ciepla, Eberhard Krause, ...
Peptide : HLSNVSSTGSIDMVDSPQLATLADEVSASLAK - GlyConnectExPASy
glyconnect.expasy.org
Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation ( Caroline Smet-Nocca, Malgorzata Broncel, ...
Phosphorylation of Toxoplasma gondii Secreted Proteins ...American Society for Microbiology
journals.asm.org
von JC Young · · Zitiert von: 9 — Joanna C. Young,a Malgorzata Broncel,a,e Helena Teague,a* Matt R. G. Russell,b Olivia L. McGovern,c* Matt Renshaw,d.
Phosphorylation of toxoplasma gondii secreted proteins during ...The University of Edinburgh
www.research.ed.ac.uk
Joanna C. Young, Malgorzata Broncel, Helena Teague, Matt R. G. Russell, Olivia L. McGovern, Matt Renshaw, David Frith, Ambrosius P Snijders, Lucy Collinson, ...
ProteomeXchange Dataset PXD ProteomeXchange
proteomecentral.proteomexchange.org
PrimarySubmitter, Malgorzata Broncel. SpeciesList, scientific name: Toxoplasma gondii RH; NCBI TaxID: ; scientific name: Homo sapiens (Human); NCBI ...
Resultados de búsqueda - "Dan Fitz"una.edu.ni
buscador.una.edu.ni
... Clare Beesley, Nisha Bhardwaj, Shahnaz Bibi, Ganka Bineva-Todd, Dhruva Biswas, Michael J. Blackman, Dominique Bonnet, Faye Bowker, Malgorzata Broncel, ...
Search, page 3eLife
elifesciences.org
Malgorzata Broncel, Caia Dominicus ... Moritz Treeck. Myristoylation of a secreted protein, identified in a global myristoylation analysis of the eukaryotic ...
Validation of N-myristoyltransferase as an antimalarial drug ...Worktribe
nottingham-repository.worktribe.com
von M Wright · Zitiert von: 210 — Malgorzata Broncel. Remigiusz Serwa. Declan Brady. David Mann. Robin Leatherbarrow. RITA TEWARI .UK
Dual Targeting of PDGFRα and FGFR1 Displays ...korea.ac.kr
pure.korea.ac.kr
— Jocelyn P. Wong, Jason R. Todd, Martina A. Finetti, Frank McCarthy, Malgorzata Broncel, Simon Vyse, Maciej T. Luczynski, Stephen Crosier, ...
Verwandte Suchanfragen zu Malgorzata Broncel
| Eberhard Krause Beate Koksch Moritz Treeck | Corinna Mattheis |
Person "Broncel" (1) Vorname "Malgorzata" (1715) Name "Broncel" (17) |
sortiert nach Relevanz / Datum